PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462888593
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-PHD
Protein Properties Length: 693aa    MW: 76012.9 Da    PI: 4.396
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462888593genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox19.22.1e-066536831343
                HHHHHHHHHSSS--HHHHHHHHHHCTS-HHH CS
   Homeobox  13 eeLeelFeknrypsaeereeLAkklgLterq 43 
                ++L e+F+ ++yps++ +e LA++lg+t rq
  462888593 653 QRLHEHFKTEQYPSRDVKESLAEELGITPRQ 683
                689*************************998 PP

2PHD409e-14282337151
                SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
        PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                +C+ Cg+   + +++++lCdg C++ fH++Cl++ l +e++p+g   wlC+ C++k
  462888593 282 FCATCGSkdVTLNNDIILCDGvCDRGFHQNCLSPALLTEDIPDGdkGWLCPACDCK 337
                7******64445********77*********************999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579035.54E-14272341IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.102.8E-13278336IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.976280337IPR019787Zinc finger, PHD-finger
CDDcd155041.89E-24282334No hitNo description
SMARTSM002491.7E-10282335IPR001965Zinc finger, PHD-type
PfamPF006285.5E-11282337IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590283334IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.608.4E-7630683IPR009057Homeodomain-like
SuperFamilySSF466895.56E-5641683IPR009057Homeodomain-like
CDDcd000863.05E-6647683No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
ASPTPSAPAP AGDESRRPRS CFAAARGCQV LVNQAQLSRA SGFWAFFVNC KLTNFFGYHT  60
MDKNTDPCPI EGNGEIGNNV SSSQNPETLE QQVSPSTSQV VQNTMGVRKN YKRAANRGKN  120
GSQVLTGKKY TLRSSGNDTR VLRSKSNSMV VPAEPVQPPV QPPAKRRKRG RPSKGNPGKR  180
GRPSNGGPSD EFSQIRNRVK YILHKMGYEQ NMLEAYANEG WKSQSLEKIR PEKELERAKG  240
EILRRKLQIR EVFQNLDSLL SKGKIDESLF DSDGEIASED IFCATCGSKD VTLNNDIILC  300
DGVCDRGFHQ NCLSPALLTE DIPDGDKGWL CPACDCKIDC IKEINELQGS DISIDDSWEK  360
VFPEAAALAN GSKQDETLDL PSDDSEDDDF DPDMAEEHVA SKEEGSSEED EDEGSDSDDS  420
NFLTSSDSEP LMNKKKADDL GLPSEDSEDD DYDPAGPDSD KDIQKEKSSS DESDFTSDSD  480
EFCVEIAKSG DHDEVSKPSF PDAEAGDTTC DMGKSTALAD TANSSLNSME AEMNQNLVLP  540
GSGRRKVERL DYKKLYDETY DKESSDSSDD EEWSGNSTPE KGNEESSEDE ANPSAVKSSR  600
RTRVAPHNGE LTPQTGHPDS LHGSADQKCG GDLTSNGSNS TTRKGQFGPI INQRLHEHFK  660
TEQYPSRDVK ESLAEELGIT PRQWLLLTGQ QMV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1542549GRRKVERL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961485.10.0PREDICTED: homeobox protein HOX1A-like
SwissprotP466050.0HOX1A_MAIZE; Homeobox protein HOX1A
TrEMBLA0A0A9GE960.0A0A0A9GE96_ARUDO; Hox1a
STRINGSi021365m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43933768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.16e-80Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain